.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of peptide-binding domain of Kar2 protein from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 3h0x Target Id APC89502.3
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS26941,NP_012500.1, 4932 Molecular Weight 16120.48 Da.
    Residues 149 Isoelectric Point 5.38
    Sequence dvnaltlgiettggvmtplikrntaiptkksqifstavdnqptvmikvyegeramskdnnllgkfeltg ippaprgvpqievtfaldangilkvsatdkgtgksesititndkgrltqeeidrmveeaekfasedasi kakvesrnkle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.230
    Matthews' coefficent 2.65 Rfactor 0.186
    Waters 120 Solvent Content 53.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3h0x

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch