.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h0k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a. To be Published
    Site MCSG
    PDB Id 3h0k Target Id APC89436.2
    Related PDB Ids 3lw7 
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS26939,AAK41303.1, 3.40.50.300.51, 273057 Molecular Weight 20405.56 Da.
    Residues 178 Isoelectric Point 8.49
    Sequence kvilitgmpgsgksefakllkergakvivmsdvvrkrysieakpgerlmdfakrlreiygdgvvarlcv eelgtsnhdlvvfdgvrslaeveefkrllgdsvyivavhsppkirykrmierlrsddskeiselirrdr eelklgigeviamadyiitndsnyeefkrrceevtdrvlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.25 Rfree 0.294
    Matthews' coefficent 2.69 Rfactor 0.221
    Waters 10 Solvent Content 54.40

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3h0k

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch