The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Putative Nicotinate-nucleotide Adenylyltransferase from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3h05 Target Id APC61261
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5569,BAC61756.1,, 223926 Molecular Weight 19981.97 Da.
    Residues 177 Isoelectric Point 5.94
    Sequence mkkiaifgsafnppslghksvieslshfdlvllepsiahawgknmldypircklvdafikdmglsnvqr sdleqalyqpgqsvttyallekiqeiyptaditfvigpdnffkfakfykaeeiterwtvmacpekvkir stdirnaliegkdistyttptvselllneglyretlsgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.214
    Matthews' coefficent 2.40 Rfactor 0.194
    Waters 305 Solvent Content 48.30

    Ligand Information
    Metals CL (CHLORIDE) x 2


    Google Scholar output for 3h05
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch