The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Calcineurin-like Phosphoesterase from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 3gve Target Id APC62077.1
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS26906,CAB12613.1,, 224308 Molecular Weight 36883.44 Da.
    Residues 338 Isoelectric Point 5.15
    Sequence esaapqvhlsilattdihanmmdydyysdketadfglartaqliqkhreqnpntllvdngdliqgnplg eyavkyqkddiisgtkthpiisvmnalkydagtlgnhefnygldfldgtikgadfpivnanvkttsgen rytpyvinektlidengneqkvkvgyigfvppqimtwdkknlegqvqvqdivesanetipkmkaegadv iialahtgiekqaqssgaenavfdlatktkgidaiisghqhglfpsaeyagvaqfnvekgtingipvvm psswgkylgvidlklekadgswkvadskgsiesiagnvtsrnetvtntiqqthqntleyvrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.163
    Matthews' coefficent 2.08 Rfactor 0.154
    Waters 813 Solvent Content 40.95

    Ligand Information
    Ligands CIT (CITRIC) x 2
    Metals MN (MANGANESE) x 2;MG (MAGNESIUM) x 3


    Google Scholar output for 3gve

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch