.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gnj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a thioredoxin-related protein from Desulfitobacterium hafniense DCB. To be Published
    Site MCSG
    PDB Id 3gnj Target Id APC92103
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb
    Alias Ids TPS26949,ZP_01371852.1, 272564 Molecular Weight 12653.72 Da.
    Residues 108 Isoelectric Point 4.42
    Sequence mslekldtntfeqliydegkaclvmfsrknchvcqkvtpvleelrlnyeesfgfyyvdveeektlfqrf slkgvpqilyfkdgeykgkmagdveddeveqmiadvled
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.99 Rfree 0.26605
    Matthews' coefficent 1.84 Rfactor 0.19605
    Waters 90 Solvent Content 33.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gnj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch