.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gl5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable DsbA oxidoreductase SCO1869 from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 3gl5 Target Id APC40006
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS26875,NP_626136.1, 100226 Molecular Weight 25782.25 Da.
    Residues 237 Isoelectric Point 4.80
    Sequence mrveiwsdiacpwcyvgkarfekalaafphrdgvevvhrsfeldpgrakddvqpvltmltakygmsqeq aqagednlgaqaaaeglayrtrdrdhgstfdlhrllhlakergrhealldafyrgnfadersvfndder lvelavgagldaeevravladpaayadevradereaaqlgatgvpffvldraygvsgaqpaevftqalt qawgertplkliddggaeacgpdgcavpgh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.24632
    Matthews' coefficent 2.31 Rfactor 0.20015
    Waters 144 Solvent Content 46.80

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3gl5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch