.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gl1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 3gl1 Target Id APC90063.1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS26947,NP_010052.1, 4932 Molecular Weight 41771.01 Da.
    Residues 384 Isoelectric Point 5.32
    Sequence maegvfqgaigidlgttyscvatyessveiianeqgnrvtpsfvaftpeerligdaaknqaalnprntv fdakrligrrfddesvqkdmktwpfkvidvdgnpvievqyleetktfspqeisamvltkmkeiaeakig kkvekavitvpayfndaqrqatkdagaisglnvlriineptaaaiayglgagksekerhvlifdlgggt fdvsllhiaggvytvkstsgnthlggqdfdtnllehfkaefkkktgldisddaralrrlrtaaerakrt lssvtqttvevdslfdgedfessltrarfedlnaalfkstlepveqvlkdakisksqidevvlvggstr ipkvqkllsdffdgkqleksinpdeavaygaavqgailt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.92 Rfree 0.21776
    Matthews' coefficent 2.18 Rfactor 0.16408
    Waters 670 Solvent Content 43.45

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 7;MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 3gl1
    1. Ribosome-associated chaperones as key players in proteostasis
    S Preissler, E Deuerling - Trends in Biochemical Sciences, 2012 - Elsevier
     
    2. Withanone binds to mortalin and abrogates mortalin-p53 complex: computational and experimental evidence
    A Grover, D Priyandoko, R Gao, A Shandilya - International Journal of , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch