.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gku

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940. To be Published
    Site MCSG
    PDB Id 3gku Target Id APC21302
    Molecular Characteristics
    Source Clostridium symbiosum atcc 14940
    Alias Ids TPS26869,KG07BSVVORF/C/INX8V5NYKEXLO, 411472 Molecular Weight 25547.83 Da.
    Residues 222 Isoelectric Point 8.87
    Sequence mdmvtvtaktveeavtkalielqttsdkltyeivekgsagflgigskpaiirakrketlqdkaiefleq vfdamnmavdisveynetekemnvnlkgddmgiligkrgqtldslqylvslvvnksssdyirvkldten yrerrketletlakniaykvkrtkrsvslepmnpyerriihaalqndkyvvtrsdgeepfrhviislkr enrrdrndrsdrnek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.95 Rfree 0.28741
    Matthews' coefficent 3.15 Rfactor 0.21969
    Waters Solvent Content 60.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gku

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch