.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gjy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a probable spermidine synthase from Corynebacterium glutamicum ATCC 13032. To be Published
    Site MCSG
    PDB Id 3gjy Target Id APC62791
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS26916,CAF19940.1, 3.40.50.150, 196627 Molecular Weight 34479.70 Da.
    Residues 314 Isoelectric Point 5.48
    Sequence markkntsdqsrsqaantpiagtyegeysvieleadsyttdgwlisingvpsshivlgqpqalefeymr wiatgarafidahqdasklrithlgggactmaryfadvypqsrntvveldaelarlsrewfdipraprv kirvddarmvaesftpasrdviirdvfagaitpqnfttveffehchrglapgglyvancgdhsdlrgak selagmmevfehvaviadppmlkgrrygniilmgsdteffssnsteasaitrellgggvpaqykdeswv rkfasgaqarhdgvstlqmpsdtpqhpaetpehsntqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.47 Rfree 0.19152
    Matthews' coefficent 2.13 Rfactor 0.15704
    Waters 385 Solvent Content 42.30

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gjy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch