.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ghd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain. To be Published
    Site MCSG
    PDB Id 3ghd Target Id APC40009
    Molecular Characteristics
    Source Pyrococcus furiosus dsm 3638
    Alias Ids TPS26881,NP_579682.1, 186497 Molecular Weight 20191.26 Da.
    Residues 179 Isoelectric Point 5.04
    Sequence maqkilveqvvkrkaivvqpkdtvdrvakilsrnkagsavvmegdeilgvvterdildkvvakgknpke vkveeimtknpvkieydydiedvielmtekgvrrvlvtkfgkpigfvtaadilaalashnheeeeeere eesevygicevcgqygalykvyhegrelwvcetckdliegr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.81 Rfree 0.24108
    Matthews' coefficent 2.25 Rfactor 0.19229
    Waters 112 Solvent Content 45.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ghd
    1. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch