.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gdw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sigma-54 interaction domain protein from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 3gdw Target Id APC62877.1
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS26918,AAO80815.1, 3.40.50.510, 226185 Molecular Weight 15103.69 Da.
    Residues 136 Isoelectric Point 5.10
    Sequence nvgvfvlmhgdstassmlktaqellgtsigtamnmpltmevqtmyeqlrnqvitqkeslnngillltdm gslnsfgnmlfeetgirtkaitmtstmivleairmasvgrslediyqniqlsfesvvreqfrsslqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21431
    Matthews' coefficent 2.29 Rfactor 0.18349
    Waters 200 Solvent Content 46.24

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gdw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch