.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g8w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a probable acetyltransferase from Staphylococcus epidermidis ATCC 12228. To be Published
    Site MCSG
    PDB Id 3g8w Target Id APC61042
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS26892,AAO04185.1, 3.40.630.30, 176280 Molecular Weight 19495.80 Da.
    Residues 166 Isoelectric Point 4.82
    Sequence mnnirllnqndldsyielmkfghhnyewdryylenvsidrlktilsnhtdywnifgafeddelvatctl kqmnyvgkchkailennfvknndeivnrelinhiiqyakeqnietlmiaiasnnisakvffssigfenl afeknaskigneyfdenwliysttessd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.25626
    Matthews' coefficent 3.69 Rfactor 0.21323
    Waters 21 Solvent Content 66.69

    Ligand Information
    Ligands NHE (2-[N-CYCLOHEXYLAMINO]ETHANE) x 12;FLC (CITRATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3g8w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch