.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g7g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Clostridium acetobutylicum ATCC 824. To be Published
    Site MCSG
    PDB Id 3g7g Target Id APC88000
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS26937,AAK81253.1, BIG_862, 272562 Molecular Weight 17921.66 Da.
    Residues 158 Isoelectric Point 5.46
    Sequence mditnikemnyeevfsititvdkpiligqddivgrrqlipiisgkvsgnnfngkvlpggidsqivrpdg kcelsaryairlddgaaiyienngirtvpdeyieavksgefvdpnayyfrtiptfetyspkykwmmnhi fvccasrlpenvllkfykis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.99 Rfree 0.25370
    Matthews' coefficent 2.28 Rfactor 0.19344
    Waters 506 Solvent Content 46.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3g7g

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch