The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative bacteriophage protein from Escherichia coli str. K-12 substr. MG1655. TO BE PUBLISHED
    Site MCSG
    PDB Id 3g27 Target Id APC7442
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS5137,NP_415081.1, 83333 Molecular Weight 10347.41 Da.
    Residues 96 Isoelectric Point 8.28
    Sequence madlrkaargrecqvripgvcngnpetsvlahirltglcgtgtkppdliatiacsachdeidrrthfvd agyakecalegmartqviwlkegvika
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.249
    Matthews' coefficent 2.27 Rfactor 0.186
    Waters 44 Solvent Content 45.80

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals ZN (ZINC) x 1;CA (CALCIUM) x 1


    Google Scholar output for 3g27

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch