.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fzv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PA01 protein, putative LysR family transcriptional regulator from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 3fzv Target Id APC7309
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5113,NP_248909.1, 208964 Molecular Weight 34017.23 Da.
    Residues 306 Isoelectric Point 5.94
    Sequence masytlrqlkyfvttvecgsvaeasrklyiaqpsistavkgleesfgvqlfirhhaqgvsltpagarfy rkaqellrmahefeqnaladndviagqidigcfetvaplylpgliagfrqaypgveirirdgeqqelvq gltsgrfdlaflyehdldstieteplmppqrphallpeghrfagqaqvslrdlclepmilldvqpsrty fvslfeelgltpniafsspsiemvrgmvgqgfgfsllvtrphsectydgkkvvmvdlaepvstsglaaa wlkraqltkparlfvdycreqlgklaerrh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.71 Rfree 0.27899
    Matthews' coefficent 2.22 Rfactor 0.22435
    Waters 28 Solvent Content 44.52

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fzv
    1. Structural studies on the full_length LysR_type regulator TsaR from Comamonas testosteroni T_2 reveal a novel open conformation of the tetrameric LTTR fold
    D Monferrer, T Tralau, MA Kertesz, I Dix - Molecular , 2010 - Wiley Online Library
     
    2. Full-length structures of BenM and two variants reveal different oligomerization schemes for LysR-type transcriptional regulators
    A Ruangprasert, SH Craven, EL Neidle - Journal of molecular , 2010 - Elsevier
     
    3. Identification of gene products involved in the oxidative stress response of Moraxella catarrhalis
    TC Hoopman, W Liu, SN Joslin, C Pybus - Infection and , 2011 - Am Soc Microbiol
     
    4. Crystal Structure of the AmpR Effector Binding Domain Provides Insight into the Molecular Regulation of Inducible AmpC _-Lactamase
    MD Balcewich, TM Reeve, EA Orlikow - Journal of molecular , 2010 - Elsevier
     
    5. Crystal structures of DntR inducer binding domains in complex with salicylate offer insights into the activation of LysR_type transcriptional regulators
    L Devesse, I Smirnova, R Lnneborg - Molecular , 2011 - Wiley Online Library
     
    6. The structure of a reduced form of OxyR from Neisseria meningitidis
    S Sainsbury, J Ren, J Nettleship - BMC structural , 2010 - biomedcentral.com
     
    7. Structural characterization and biophysical studies of BenM, a LysR-type transcriptional regulator in Acinetobacter baylyi ADP1
    A Ruangprasert - 2010 - ugakr-maint.libs.uga.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch