.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fyn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS3. To be Published
    Site MCSG
    PDB Id 3fyn Target Id APC7775
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS26810,AUS0161_1_155, 491076 Molecular Weight 16605.21 Da.
    Residues 155 Isoelectric Point 6.09
    Sequence lspqvrtahigdvpvlvrlmsefyqeagfalphdaairafkallgkpdlgriwliaegtesvgyivltl gfsmeygglrgfvddffvrpnargkglgaaalqtvkqgccdlgvrallvetgpedhpargvysragfee sgrmllgqalappihea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.207
    Matthews' coefficent 1.75 Rfactor 0.179
    Waters 122 Solvent Content 29.60

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3fyn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch