.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fxh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of Halifax Harbour Sewage Outfall: Integron Cassette Protein HFX_CASS2. To be Published
    Site MCSG
    PDB Id 3fxh Target Id APC7779
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS26854,AUS0255_1_114, 491076 Molecular Weight 12935.98 Da.
    Residues 114 Isoelectric Point 5.46
    Sequence mnnkhatsavheiireicrlvdsghsmtrdqfhelseqerfiaflaekysstiklyyladssplfekdt ssfienafgrhantvvmedfglksnalllainiclailreingev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.241
    Matthews' coefficent 1.96 Rfactor 0.186
    Waters 96 Solvent Content 37.21

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fxh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch