.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fw2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of C-terminal domain of putative thiol-disulfide oxidoreductase from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 3fw2 Target Id APC61456.1
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS25138,AAO77951.1, 3.40.30.10, 226186 Molecular Weight 16883.43 Da.
    Residues 147 Isoelectric Point 9.27
    Sequence kseigkyapffslpnakgekitrssdafkqksllinfwaswndsisqkqsnselreiykkykknkyigm lgisldvdkqqwkdaikrdtldweqvcdfgglnsevakqysiykipanillssdgkilaknlrgeelkk kieniveea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.74 Rfree 0.204
    Matthews' coefficent 2.59 Rfactor 0.164
    Waters 742 Solvent Content 52.55

    Ligand Information
    Ligands ACT (ACETATE) x 4;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3fw2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch