.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fvv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Bordetella pertussis Tohama I. To be Published
    Site MCSG
    PDB Id 3fvv Target Id APC60220
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS25110,CAE40620.1, 3.40.50.1000, 257313 Molecular Weight 25725.51 Da.
    Residues 232 Isoelectric Point 4.97
    Sequence mttrrlalfdldhtllpldsdyqwadflartgragdpaearrrnddlmerynrgeltaeqaaefmlgll aahspvelaawheefmrdvirpsltvqavdvvrghlaagdlcalvtatnsfvtapiarafgvqhliatd peyrdgrytgriegtpsfregkvvrvnqwlagmglalgdfaesyfysdsvndvplleavtrpiaanpsp glreiaqargwqvidlfdhledaks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.23521
    Matthews' coefficent 2.29 Rfactor 0.18164
    Waters 159 Solvent Content 46.36

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fvv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch