The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the histidinol-phosphate aminotransferase from Clostridium acetobutylicum. To be Published
    Site MCSG
    PDB Id 3ftb Target Id APC88736
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS25169,NP_347997.1, PF00155.11, 272562 Molecular Weight 41163.50 Da.
    Residues 361 Isoelectric Point 7.51
    Sequence myqkfkggdlmihggdiytegvfkgrelldyssninplgipksflnnidegiknlgvypdvnyrrlnks ienylklkdigivlgngaseiielsislfekiliivpsyaeyeinakkhgvsvvfsyldenmcidyedi iskiddvdsviignpnnpngglinkekfihvlklaeekkktiiideafieftgdpsssfvgeiknyscl fiiramtkffampgirfgygitnnkeiaakikakqnpwnincfaemaainclkdtnyieesllwikker krfieelnkigfikrvfsphanfvlcrlenisgeklydsllkedivirrccnfiglddsfvrfaikdek kntkflralkgvennl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.2123
    Matthews' coefficent 2.31 Rfactor 0.1745
    Waters 601 Solvent Content 46.82

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 10


    Google Scholar output for 3ftb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch