.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fsg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alpha/beta superfamily hydrolase from Oenococcus oeni PSU-1. To be Published
    Site MCSG
    PDB Id 3fsg Target Id APC60841
    Molecular Characteristics
    Source Oenococcus oeni psu
    Alias Ids TPS25121,ABJ57662.1, 3.40.50.1820, 203123 Molecular Weight 30832.31 Da.
    Residues 269 Isoelectric Point 5.05
    Sequence mkeyltrsnisyfsigsgtpiiflhglsldkqstclffeplsnvgqyqriyldlpgmgnsdpispstsd nvletlieaieeiigarrfilyghsyggylaqaiafhlkdqtlgvfltcpvitadhskrltgkhinile edinpvenkeyfadflsmnviinnqawhdyqnliipglqkedktfidqlqnnysftfeeklkninyqfp fkimvgrndqvvgyqeqlklinhnengeivllnrtghnlmidqreavgfhfdlfldelnsnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.22514
    Matthews' coefficent 2.28 Rfactor 0.17991
    Waters 492 Solvent Content 46.04

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 7;GOL (GLYCEROL) x 2;SO4 (SULFATE) x 7
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3fsg
    1. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch