The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative TrpR protein from Ruminococcus obeum. To be Published
    Site MCSG
    PDB Id 3frw Target Id APC21159
    Molecular Characteristics
    Source Ruminococcus obeum atcc 29174
    Alias Ids TPS25104,9/XUO1CT8HUIZBRC2DYLST9NQTU, 411459 Molecular Weight 12019.03 Da.
    Residues 104 Isoelectric Point 5.31
    Sequence mgkkirteevdhlfeailclknkeecytffedvctinellslsqrfevakmltdkrtyldisektgast atisrvnrslnygndgyemvfsrmkeketagktee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.05 Rfree 0.218
    Matthews' coefficent 2.84 Rfactor 0.180
    Waters 436 Solvent Content 56.71

    Ligand Information
    Ligands ACT (ACETATE) x 3


    Google Scholar output for 3frw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch