.
The Open Protein Structure Annotation Network
PDB Keyword
.

3frm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown conserved protein from Staphylococcus epidermidis ATCC 12228. To be Published
    Site MCSG
    PDB Id 3frm Target Id APC61048
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS25125,AAO05496.1, 3.40.630.30, 176280 Molecular Weight 29113.90 Da.
    Residues 251 Isoelectric Point 5.83
    Sequence mskitfkdiyidgnkitedsrkaiyllppqplkyasntwiyktmptmnqwlkdievqkkmhlnqssyhl sfsfpanekidevllekirelgfqigvlelyvieakalkelsrkrdvdiqlvssnnindylhvydafar pfgdsyanmvkqhiyssynlddierlvayvnhqpvgivdiimtdktieidgfgvleefqhqgigseiqa yvgrmanerpvilvadgkdtakdmylrqgyvyqgfkyhilkeni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.32 Rfree 0.26346
    Matthews' coefficent 2.54 Rfactor 0.19667
    Waters 313 Solvent Content 51.49

    Ligand Information
    Ligands SO4 (SULFATE) x 8;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 3
    Metals NA (SODIUM) x 6

    Jmol

     
    Google Scholar output for 3frm
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch