.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fnb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acylaminoacyl-peptidase SMU_737 from Streptococcus mutans UA159. To be Published
    Site MCSG
    PDB Id 3fnb Target Id APC61094
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS25127,AAN58462.1, 3.40.50.1820, 210007 Molecular Weight 45885.90 Da.
    Residues 402 Isoelectric Point 5.45
    Sequence mkenntilkrqdykikfnnkdmdfcfnwmlgigqiigmsagelfyiasgirdgnptdwckrfnehadyl edevervkkvgyrdlishlyfsacfsiraalqftdpkdsefmenfrrmeklfmlavdnskiplksievp fegellpgyaiisedkaqdtlivvgggdtsredlfymlgysgwehdynvlmvdlpgqgknpnqglhfev daraaisaildwyqaptekiaiagfsgggyftaqavekdkrikawiastpiydvaevfrisfstalkap ktilkwgsklvtsvnkvaevnlnkyawqfgqvdfitsvnevleqaqivdynkidvpslflvgagedsel mrqsqvlydnfkqrgidvtlrkfssesgadahcqvnnfrlmhyqvfewlnhifkkkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.12 Rfree 0.225
    Matthews' coefficent 2.07 Rfactor 0.1730
    Waters 251 Solvent Content 40.66

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2;PGE (TRIETHYLENE) x 2;EDO (1,2-ETHANEDIOL) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3fnb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch