.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fna

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The CBS Pair of possible D-arabinose 5-phosphate isomerase yrbH from Escherichia coli CFT073. TO BE PUBLISHED
    Site MCSG
    PDB Id 3fna Target Id APC62887.2
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS25158,AAN82397.1, 3.20.20.70, 199310 Molecular Weight 16032.86 Da.
    Residues 146 Isoelectric Point 6.71
    Sequence kargftaedfalshpggalgrklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmm iegiftdgdlrrvfdmgvdvrrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvl hmhdllra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.243
    Matthews' coefficent 2.13 Rfactor 0.211
    Waters 66 Solvent Content 42.14

    Ligand Information
    Ligands AMP (ADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fna
    1. Crystal Structures of the CBS and DRTGG Domains of the Regulatory Region of Clostridium perfringens Pyrophosphatase Complexed with the Inhibitor
    H Tuominen, A Salminen, E Oksanen, J Jmsen - Journal of molecular , 2010 - Elsevier
     
    2. Mutational analysis of residues in the regulatory CBS domains of Moorella thermoacetica pyrophosphatase corresponding to disease-related residues of human
    R Lahti, J Jmsen, H Tuominen, AA Baykov - 2011 - tara.tcd.ie
     
    3. The CBS Domain: A Protein Module with an Emerging Prominent Role in Regulation
    AA Baykov, HK Tuominen, R Lahti - ACS Chemical Biology, 2011 - ACS Publications
     
    4. Probing the active site of the sugar isomerase domain from E. coli arabinose_5_phosphate isomerase via X_ray crystallography
    LJ Gourlay, S Sommaruga, M Nardini - Protein , 2010 - Wiley Online Library
     
    5. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch