.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fn2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative sensor histidine kinase domain from Clostridium symbiosum ATCC 14940. TO BE PUBLISHED
    Site MCSG
    PDB Id 3fn2 Target Id APC21265.1
    Molecular Characteristics
    Source Clostridium symbiosum atcc 14940
    Alias Ids TPS25108,WB9PYGLPVHCI2HNSEVCZD3JAW9W, 411472 Molecular Weight 12280.17 Da.
    Residues 103 Isoelectric Point 4.83
    Sequence ngytmqrdnqktlavymfeeinrdveylsgrlsekelkdkyryygrgyvritdkdgqvityedgsvqdk tvfltneganklgwkleflidekmfeeeilekqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.251
    Matthews' coefficent 2.16 Rfactor 0.187
    Waters 154 Solvent Content 43.18

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 3fn2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch