.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ffh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of histidinol-phosphate aminotransferase from Listeria innocua Clip11262. To be Published
    Site MCSG
    PDB Id 3ffh Target Id APC88260
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS25167,NP_471373.1, PF00155.11, 272626 Molecular Weight 40060.63 Da.
    Residues 360 Isoelectric Point 5.06
    Sequence mkwkkslaglssykpgkreeevmaelgltkitklssnenplgtskkvaaiqanssveteiypdgwassl rkevadfyqleeeeliftagvdelielltrvlldtttntvmatptfvqyrqnaliegaevreipllqdg ehdlegmlnaidekttivwicnpnnptgnyieladiqafldrvpsdvlvvldeayieyvtpqpekhekl vrtyknliitrtfskiyglasarvgygiadkeiirqlnivrppfnttsigqklaieaikdqafigecrt snangikqyeafakrfekvklypangnfvlidlgieagtifsylekngyitrsgaalgfptavritigk eednsaviallekll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.31 Rfree 0.25211
    Matthews' coefficent 2.48 Rfactor 0.20603
    Waters 125 Solvent Content 50.47

    Ligand Information
    Ligands SO4 (SULFATE) x 9
    Metals

    Jmol

     
    Google Scholar output for 3ffh
    1. Molecular cloning, overexpression, purification, crystallization and preliminary X-ray diffraction studies of histidinol phosphate aminotransferase (HisC2) from
    N Nasir, R Vyas, C Chugh, MS Ahangar - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch