.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ff4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein CHU_1412. To be Published
    Site MCSG
    PDB Id 3ff4 Target Id APC62842
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS25156,ABG58683.1, 3.40.50.720, 269798 Molecular Weight 13272.62 Da.
    Residues 119 Isoelectric Point 5.71
    Sequence mkktlilgatpetnryaylaaerlkshghefipvgrkkgevlgktiinerpviegvdtvtlyinpqnql seynyilslkpkrvifnpgteneeleeilsengiepvigctlvmlsagtf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.19826
    Matthews' coefficent 3.40 Rfactor 0.17909
    Waters 65 Solvent Content 63.79

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ff4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch