.
The Open Protein Structure Annotation Network
PDB Keyword
.

3feu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of DsbA-like thioredoxin domain VF_A0457 from Vibrio fischeri. To be Published
    Site MCSG
    PDB Id 3feu Target Id APC61802.1
    Molecular Characteristics
    Source Vibrio fischeri es114
    Alias Ids TPS25146,AAW87527.1, 3.40.30.10, 312309 Molecular Weight 20114.51 Da.
    Residues 182 Isoelectric Point 4.65
    Sequence dpkegvqyevlstslendgmapvtevfalscghcrnmenflpvisqeagtdigkmhitfnqsahiasmf yyaaemqvdgapdhafmedlfaatqmgegttlteqqeayskaftsrglvspydfneeqrdtlikkvdna kmlseksgissvptfvvngkynvligghddpkqiadtiryllek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.241
    Matthews' coefficent 2.00 Rfactor 0.188
    Waters 170 Solvent Content 38.62

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3feu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch