The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Electron Transfer Flavoprotein Subunit Alpha related Protein Ta0212 from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 3fet Target Id APC61165.2
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS25129,CAC11358.1,, 2303 Molecular Weight 17786.38 Da.
    Residues 163 Isoelectric Point 5.91
    Sequence mkfltvsddmnflrqvntlvagkgdmdsviigegdakglgskvlyrakkgtpfdavsegilkiagnydy iaigstevgreiagylsfktgfytateifslefngqkahtkrffyggktvieeesdariltvapgviea kdlgttpeirdleigqsrikitkfv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.05 Rfree 0.232
    Matthews' coefficent 2.30 Rfactor 0.179
    Waters 340 Solvent Content 46.55

    Ligand Information


    Google Scholar output for 3fet

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch