.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fdj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a DegV family protein from Eubacterium eligens. TO BE PUBLISHED
    Site MCSG
    PDB Id 3fdj Target Id APC21124
    Molecular Characteristics
    Source Eubacterium eligens
    Alias Ids TPS25102,ZVNW5VJFOAACMF8NLOPRFTMWH60, 39485 Molecular Weight 30005.79 Da.
    Residues 275 Isoelectric Point 5.36
    Sequence mrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsytacpgidawleaf gdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgpqmriileqlqqmieegkkfee idgaidaymqktrlfcslkslhnlaqngrvskvvasaaevlgisvigtasshgtleaigkcrgdkkllv klqallddagyeggklrichvenealadkiadmikqaygttdvcvykagglcsyyaerggiilscetk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.191
    Matthews' coefficent 2.50 Rfactor 0.160
    Waters 317 Solvent Content 50.87

    Ligand Information
    Ligands P6G (HEXAETHYLENE) x 1;EDO (1,2-ETHANEDIOL) x 1;PG4 (TETRAETHYLENE) x 1;ACY (ACETIC) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3fdj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch