.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fdi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein from Eubacterium ventriosum ATCC 27560. To be Published
    Site MCSG
    PDB Id 3fdi Target Id APC21034
    Molecular Characteristics
    Source Eubacterium ventriosum atcc 27560
    Alias Ids TPS25100,YDLVWFE4U+SUGUTEL3T3O8C0F+K, 411463 Molecular Weight 22745.05 Da.
    Residues 198 Isoelectric Point 6.85
    Sequence mkqiiiaigrefgsgghlvakklaehyniplyskelldevakdgryskevlerfdekpmnfafipvpag gttisleqdiairqfnfirkkaneekesfvivgrcaeeilsdnpnmisafilgdkdtktkrvmeregvd ektalnmmkkmdkmrkvyhnfyceskwgdsrtydicikigkvdvdtatdmiikyidsrdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.24384
    Matthews' coefficent 2.43 Rfactor 0.19751
    Waters 63 Solvent Content 49.32

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3fdi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch