The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 3fb9 Target Id APC80713
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5619,AAK76253, 170187 Molecular Weight 10211.21 Da.
    Residues 88 Isoelectric Point 5.39
    Sequence msdaftdvakmkkikeeikahegqvvemtlengrkrqknrlgklievypslfivefgdvegdkqvnvyv esftysdilteknlihyld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23436
    Matthews' coefficent 2.14 Rfactor 0.19073
    Waters 198 Solvent Content 42.55

    Ligand Information


    Google Scholar output for 3fb9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch