The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of aminoglycoside N(6')acetyltransferase from Legionella pneumophila subsp. pneumophila str. Philadelphia 1. To be Published
    Site MCSG
    PDB Id 3f5b Target Id APC60744
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS24477,AAU27065.1, 3.40.630.30, 272624 Molecular Weight 20860.96 Da.
    Residues 179 Isoelectric Point 5.90
    Sequence mmikastnefrfcfkqmnksqhelvlgwihqphinewlhgdglsntikdlheflndgkpwathwiaydn eipfaylitseiekseeypdgavtldlficrldyigkglsvqmihefilsqfsdtkivlinpeisnera vhvykkagfeiigefiaswhpvphykmklciedlkkqrlsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24399
    Matthews' coefficent 2.57 Rfactor 0.21241
    Waters 90 Solvent Content 52.10

    Ligand Information


    Google Scholar output for 3f5b

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch