.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eyt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thioredoxin-like superfamily protein SPOA0173. To be Published
    Site MCSG
    PDB Id 3eyt Target Id APC61742.1
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS24486,AAV97309.1, 3.40.30.10, 246200 Molecular Weight 16867.80 Da.
    Residues 155 Isoelectric Point 5.93
    Sequence mkapelqiqqwfnsatdltladlrgkvivieafqmlcpgcvmhgiplaqkvraafpedkvavlglhtvf ehheamtpislkaflheyrikfpvgvdqpgdgamprtmaayqmrgtpslllidkagdlrahhfgdvsel llgaeiatllgeaapsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.210
    Matthews' coefficent 2.47 Rfactor 0.173
    Waters 519 Solvent Content 50.14

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3;ACY (ACETIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 3eyt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch