.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ey7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of V. Cholerae. Integron cassette protein VCH_CASS1. To be Published
    Site MCSG
    PDB Id 3ey7 Target Id APC7785
    Molecular Characteristics
    Source Vibrio cholerae strain opvch_op2d
    Alias Ids TPS26856,AUS0056_1_133, 666 Molecular Weight 14546.86 Da.
    Residues 133 Isoelectric Point 5.65
    Sequence meflmkishldhlvltvadiptttnfyekvlgmkavsfgagrialefghqkinlhqlgnefepkaqnvr vgsadlcfitdtvlsdamkhvenqgvtimegpvkrtgaqgaitsfyfrdpdgnlievstysnt*
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2164
    Matthews' coefficent 2.24 Rfactor 0.1712
    Waters 432 Solvent Content 45.14

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3ey7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch