.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ey5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative acetyltransferase from GNAT family from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 3ey5 Target Id APC60148
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS24473,AAO77158.1, 3.40.630.30, 226186 Molecular Weight 21655.44 Da.
    Residues 178 Isoelectric Point 5.19
    Sequence mirfqpittsdvqhykfmeellvesfppeeyrelehlreytdrignfhnniifdddlpigfitywdfde fyyvehfatnpalrnggygkrtlehlceflkrpivleverpveemakrrinfyqrhgftlwekdyyqpp ykegddflpmylmvhgnldaekdyegirhklhtivygvke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.267
    Matthews' coefficent 1.81 Rfactor 0.198
    Waters 40 Solvent Content 31.89

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ey5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch