.
The Open Protein Structure Annotation Network
PDB Keyword
.

3erm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 3erm Target Id APC85034
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5755,AAO54724.1, PF07130, 223283 Molecular Weight 9684.32 Da.
    Residues 88 Isoelectric Point 4.66
    Sequence mavetlyrstrdlettfvdrkladahdqmlelaelltdvliknvpglsekhaedasiymaknravfaaa fknnatalselsepaeseg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.45 Rfree 0.26892
    Matthews' coefficent Rfactor 0.21410
    Waters 13 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3erm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch