The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site MCSG
    PDB Id 3eo4 Target Id APC60792.2
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS5558,AAB99065.1, 3.40.630.30, 243232 Molecular Weight 19286.46 Da.
    Residues 161 Isoelectric Point 9.59
    Sequence nckkigedskiiirqitdndlellmawrsnpliykffyiqkeplkweehyswwmsrenrvdwiillren ntirkvgsvnvsqlntdnpeigiligefflwgkhigrhsvslvlkwlknigykkaharilennirsikl feslgfkktkkgrenewiyevnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.19 Rfree 0.23958
    Matthews' coefficent 2.66 Rfactor 0.19536
    Waters 234 Solvent Content 53.71

    Ligand Information


    Google Scholar output for 3eo4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch