The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168. To be Published
    Site MCSG
    PDB Id 3ed5 Target Id APC60080
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS20349,CAB12552.1,, 224308 Molecular Weight 27379.70 Da.
    Residues 235 Isoelectric Point 4.83
    Sequence mkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkmtrdevvnt rfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyivtngvshtqykrlrdsgl fpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigdsltadikggqlagldtcwmnpdmkpn vpeiiptyeirkleelyhilnientvsc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.19725
    Matthews' coefficent 2.93 Rfactor 0.17113
    Waters 191 Solvent Content 58.01

    Ligand Information
    Ligands FMT (FORMIC) x 10


    Google Scholar output for 3ed5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch