The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved domain from a protein of Geobacter sulfurreducens PCA. To be Published
    Site MCSG
    PDB Id 3e0y Target Id APC87688.2
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS20363,AAR34442.1, 3.30.450.40, 243231 Molecular Weight 19935.65 Da.
    Residues 178 Isoelectric Point 5.83
    Sequence mqranrehleiisleeismlvssdfdlpevlqhvtakvatqlkvsvcniylregdevvlaathgfdpaf igkirikigdgitgsvardgqyislsrasqdpryryfpelqeekynsmlsfpigdkkevygvinlntts irsfhedeiyfvsiianliltaiklrqqvassrkaaeasa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.29089
    Matthews' coefficent 2.79 Rfactor 0.21649
    Waters Solvent Content 55.93

    Ligand Information
    Metals NA (SODIUM) x 2


    Google Scholar output for 3e0y

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch