.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dx5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional analysis of AsbF: origin of the stealth 3,4-dihydroxybenzoic acid subunit for petrobactin biosynthesis. Proc.Natl.Acad.Sci.USA 105 17133-17138 2008
    Site MCSG
    PDB Id 3dx5 Target Id APC65718
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS20357,YP_028107.1, 260799 Molecular Weight 32587.14 Da.
    Residues 280 Isoelectric Point 4.94
    Sequence mkyslctisfrhqlisftdivqfayengfegielwgthaqnlymqeyetterelnclkdktleitmisd yldislsadfektiekceqlailanwfktnkirtfagqkgsadfsqqerqeyvnrirmicelfaqhnmy vllethpntltdtlpstlellgevdhpnlkinldflhiwesgadpvdsfqqlrpwiqhyhfknissady lhvfepnnvyaaagnrtgmvplfegivnydeiiqevrdtdhfaslewfghnakdilkaemkvltnrnle vvts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.12 Rfree 0.178
    Matthews' coefficent 2.82 Rfactor 0.148
    Waters 231 Solvent Content 56.32

    Ligand Information
    Ligands DHB (3,4-DIHYDROXYBENZOIC) x 1;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;GOL (GLYCEROL) x 1
    Metals MN (MANGANESE) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3dx5
    1. Structural and functional analysis of AsbF: Origin of the stealth 3, 4-dihydroxybenzoic acid subunit for petrobactin biosynthesis
    BF Pfleger, Y Kim, TD Nusca - Proceedings of the , 2008 - National Acad Sciences
     
    2. The Missing Link in Petrobactin Biosynthesis: asbF Encodes a (_)-3-Dehydroshikimate Dehydratase
    DT Fox, K Hotta, CY Kim, AT Koppisch - Biochemistry, 2008 - ACS Publications
     
    3. Cleavable C-terminal His-tag vectors for structure determination
    WH Eschenfeldt, N Maltseva, L Stols - Journal of structural and , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch