The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a possible acetyltransferase from Clostridium difficile 630. To be Published
    Site MCSG
    PDB Id 3dsb Target Id APC60368.2
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS9388,CAJ69046.1, 3.40.630.30, 272563 Molecular Weight 18604.21 Da.
    Residues 154 Isoelectric Point 4.88
    Sequence eelieirearmddldtiakfnynlaketegkeldmdvltkgvkalllderkgkyhvytvfdkvvaqimy tyewsdwrngnflwiqsvyvdkeyrrkgifnylfnyiknicdkdenivgmrlyvekeninakatyesln myecdynmyeyevihs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.48 Rfree 0.20526
    Matthews' coefficent 2.42 Rfactor 0.16828
    Waters 431 Solvent Content 49.10

    Ligand Information
    Ligands SO4 (SULFATE) x 2;BET (TRIMETHYL) x 2


    Google Scholar output for 3dsb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch