The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of peptide-binding domain of heat shock 70 kDa protein F, mitochondrial precursor, from Caenorhabditis elegans. To be Published
    Site MCSG
    PDB Id 3dqg Target Id APC90008.12
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9395,P11141, 6239 Molecular Weight 15919.26 Da.
    Residues 148 Isoelectric Point 5.32
    Sequence dvtplslgietlggimtklitrnttiptkksqvfstaadgqtqvqikvfqgerematsnkllgqfslvg ippaprgvpqvevtfdidangivnvsardrgtgkeqqiviqssgglskdqienmikeaeknaaedakrk elvevinqae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.216
    Matthews' coefficent 2.38 Rfactor 0.183
    Waters 527 Solvent Content 48.28

    Ligand Information


    Google Scholar output for 3dqg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch