.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dnp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Stress response protein yhaX from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 3dnp Target Id APC60081.2
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS9386,CAB12822.2, 3.40.50.1000, 224308 Molecular Weight 32306.68 Da.
    Residues 287 Isoelectric Point 7.80
    Sequence mskqllalnidgallrsngkihqatkdaieyvkkkgiyvtlvtnrhfrsaqkiakslkldaklithsga yiaekidapffekrisddhtfnivqvlesyqcnirllhekysignkkkvnsnllgkalihpsdpifypv qfveslsdllmdepvsapvievytehdiqhditetitkafpavdvirvndeklnivpkgvskeaglalv aselglsmddvvaighqyddlpmielaglgvamgnavpeikrkadwvtrsndeqgvaymmkeyfrmqqr kgfldkfhmkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.207
    Matthews' coefficent 2.50 Rfactor 0.167
    Waters 249 Solvent Content 50.74

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3dnp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch