.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dmn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the C-terminal domain of a possilbe DNA helicase from Lactobacillus plantarun WCFS1. To be Published
    Site MCSG
    PDB Id 3dmn Target Id APC89291.2
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS9394,CAD63477.1, 3.40.50.300.55, 220668 Molecular Weight 18876.34 Da.
    Residues 171 Isoelectric Point 4.76
    Sequence syrstqqitdftkeilvngeavtafdrqgdlpnvvvtpnfeagvdqvvdqlamndserdttaiigksla ecealtkalkargeqvtliqtenqrlapgvivvpsflakglefdavivwnanqenyqrederqllytic sramheltlvavgslspllarvnhalytlneak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.22538
    Matthews' coefficent 2.67 Rfactor 0.19126
    Waters 188 Solvent Content 53.99

    Ligand Information
    Ligands ACT (ACETATE) x 11;EDO (1,2-ETHANEDIOL) x 2;FMT (FORMIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3dmn
    1. Biochemical and Structural Analysis of Hormone-sensitive Lipase Homolog EstE7: Insight into the Stabilized Dimerization of HSL-Homolog Proteins
    KH Nam, SH Park, WH Lee - Bull. Korean Chem. , 2010 - newjournal.kcsnet.or.kr
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch