.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dci

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of a putative arylesterase from Agrobacterium tumefaciens str. C58. TO BE PUBLISHED
    Site MCSG
    PDB Id 3dci Target Id APC7346
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5120,NP_357156.1, 176299 Molecular Weight 21863.90 Da.
    Residues 209 Isoelectric Point 6.49
    Sequence mktvlafgdsltwgadpatglrhpvehrwpdvleaelagkakvhpeglggrttcyddhagpacrngara levalschmpldlviimlgtndikpvhggraeaavsgmrrlaqivetfiykpreavpkllivapppcva gpggepaggrdieqsmrlaplyrklaaelghhffdagsvasaspvdgvhldasataaigralaapvrdilg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.184
    Matthews' coefficent 1.95 Rfactor 0.148
    Waters 482 Solvent Content 36.84

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals ZN (ZINC) x 1;CL (CHLORIDE) x 22

    Jmol

     
    Google Scholar output for 3dci
    1. Characterization of a novel oligomeric SGNH-arylesterase from Sinorhizobium meliloti 1021
    H Hwang, SB Kim, S Yoon, Y Ryu, SY Lee - International journal of , 2010 - Elsevier
     
    2. Characterization and immobilization of a novel SGNH hydrolase (Est24) from Sinorhizobium meliloti
    SY Bae, BH Ryu, E Jang, S Kim, TD Kim - Applied Microbiology and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch