.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d8u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a PurR family transcriptional regulator from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3d8u Target Id APC91343.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6023,NP_799742.1, 223926 Molecular Weight 30023.50 Da.
    Residues 272 Isoelectric Point 6.12
    Sequence ysialiipslfekacahflpsfqqalnkagyqlllgysdysieqeekllstflesrpagvvlfgsehsq rthqlleasntpvleiaelsskasylnigvdhfevgkactrhlieqgfknvgfigargnhstlqrqlhg wqsamienyltpdhflttheapssqlgaeglaklllrdsslnalvcsheeiaigalfechrrvlkvptd iaiiclegssmgehaypsltsaefdyermgtkaaekllhaikgepeerptsmgfklkrrastain
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.88 Rfree 0.28278
    Matthews' coefficent 3.10 Rfactor 0.21369
    Waters Solvent Content 60.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d8u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch