.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d6j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative haloacid dehalogenase-like hydrolase from Bacteroides fragilis. To be Published
    Site MCSG
    PDB Id 3d6j Target Id APC60104
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS5549,CAH06673.1, 3.40.50.1000, 272559 Molecular Weight 24781.76 Da.
    Residues 222 Isoelectric Point 4.91
    Sequence mkytvylfdfdytladssrgivtcfrsvlerhgytgitddmikrtigktleesfsiltgitdadqlesf rqeyskeadiymnantilfpdtlptlthlkkqgirigiistkyrfrilsflrnhmpddwfdiiiggedv thhkpdpeglllaidrlkacpeevlyigdstvdagtaaaagvsftgvtsgmttaqefqaypydriistl gqlisvpedksgcpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.235
    Matthews' coefficent 2.59 Rfactor 0.19786
    Waters 222 Solvent Content 52.56

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3d6j

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch