The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hydrogenase Assembly Chaperone HypC/HupF Family Protein from Shewanella oneidensis MR-1. To be Published
    Site MCSG
    PDB Id 3d3r Target Id APC7647
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5175,NP_717695.1, 211586 Molecular Weight 9096.89 Da.
    Residues 81 Isoelectric Point 4.73
    Sequence mclsipsqvvavdnerqsvtvdtlgvrrdvsshlmteplaigdyvlihigfvmnkidrndalqslelyq eivsklenetth
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.234
    Matthews' coefficent 2.01 Rfactor 0.202
    Waters 86 Solvent Content 38.75

    Ligand Information


    Google Scholar output for 3d3r

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch